DUSP26,DUSP24
  • DUSP26,DUSP24

Anti-DUSP26 Antibody 100ul

Ref: AN-HPA018221-100ul
Anti-DUSP26

Información del producto

Polyclonal Antibody against Human DUSP26, Gene description: dual specificity phosphatase 26 (putative), Alternative Gene Names: DUSP24, MGC1136, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BV47, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DUSP26
Gene Description dual specificity phosphatase 26 (putative)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence CPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVL
Immunogen CPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DUSP24, MGC1136
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BV47
HTS Code 3002150000
Gene ID 78986
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DUSP26 Antibody 100ul

Anti-DUSP26 Antibody 100ul