SIGLEC6,CD327,CD33L
  • SIGLEC6,CD327,CD33L

Anti-SIGLEC6 Antibody 25ul

Ref: AN-HPA018198-25ul
Anti-SIGLEC6

Información del producto

Polyclonal Antibody against Human SIGLEC6, Gene description: sialic acid binding Ig-like lectin 6, Alternative Gene Names: CD327, CD33L, CD33L1, OB-BP1, SIGLEC-6, Validated applications: IHC, Uniprot ID: O43699, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SIGLEC6
Gene Description sialic acid binding Ig-like lectin 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGT
Immunogen LPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD327, CD33L, CD33L1, OB-BP1, SIGLEC-6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43699
HTS Code 3002150000
Gene ID 946
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SIGLEC6 Antibody 25ul

Anti-SIGLEC6 Antibody 25ul