MCOLN3,FLJ11006
  • MCOLN3,FLJ11006

Anti-MCOLN3 Antibody 100ul

Ref: AN-HPA018106-100ul
Anti-MCOLN3

Información del producto

Polyclonal Antibody against Human MCOLN3, Gene description: mucolipin 3, Alternative Gene Names: FLJ11006, TRP-ML3, TRPML3, Validated applications: ICC, IHC, Uniprot ID: Q8TDD5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MCOLN3
Gene Description mucolipin 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence YENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPEIETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLT
Immunogen YENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPEIETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ11006, TRP-ML3, TRPML3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TDD5
HTS Code 3002150000
Gene ID 55283
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MCOLN3 Antibody 100ul

Anti-MCOLN3 Antibody 100ul