SLC50A1,HsSWEET1
  • SLC50A1,HsSWEET1

Anti-SLC50A1 Antibody 25ul

Ref: AN-HPA018095-25ul
Anti-SLC50A1

Información del producto

Polyclonal Antibody against Human SLC50A1, Gene description: solute carrier family 50 (sugar efflux transporter), member 1, Alternative Gene Names: HsSWEET1, RAG1AP1, RP11-540D14.5, RZPDo834D038D, SCP, slv, SWEET1, Validated applications: IHC, Uniprot ID: Q9BRV3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC50A1
Gene Description solute carrier family 50 (sugar efflux transporter), member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDG
Immunogen RMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HsSWEET1, RAG1AP1, RP11-540D14.5, RZPDo834D038D, SCP, slv, SWEET1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BRV3
HTS Code 3002150000
Gene ID 55974
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC50A1 Antibody 25ul

Anti-SLC50A1 Antibody 25ul