SCARB2,CD36L2
  • SCARB2,CD36L2

Anti-SCARB2 Antibody 100ul

Ref: AN-HPA018014-100ul
Anti-SCARB2

Información del producto

Polyclonal Antibody against Human SCARB2, Gene description: scavenger receptor class B, member 2, Alternative Gene Names: CD36L2, HLGP85, LIMP-2, LIMPII, SR-BII, Validated applications: IHC, WB, Uniprot ID: Q14108, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SCARB2
Gene Description scavenger receptor class B, member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence SFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGD
Immunogen SFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD36L2, HLGP85, LIMP-2, LIMPII, SR-BII
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14108
HTS Code 3002150000
Gene ID 950
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SCARB2 Antibody 100ul

Anti-SCARB2 Antibody 100ul