FOXK1,IMAGE:5164497
  • FOXK1,IMAGE:5164497

Anti-FOXK1 Antibody 100ul

Ref: AN-HPA017998-100ul
Anti-FOXK1

Información del producto

Polyclonal Antibody against Human FOXK1, Gene description: forkhead box K1, Alternative Gene Names: IMAGE:5164497, Validated applications: ICC, IHC, Uniprot ID: P85037, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FOXK1
Gene Description forkhead box K1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PHDPEFGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSSLVAKPVAYMPASIVTSQQPAGHAIHVVQQAPTVTMVRVVTTSANSANGYILTSQGAAGGSHDAAGAAVLDLGSEARGLEEKPTIAFATIPAAGGVIQTVA
Immunogen PHDPEFGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSSLVAKPVAYMPASIVTSQQPAGHAIHVVQQAPTVTMVRVVTTSANSANGYILTSQGAAGGSHDAAGAAVLDLGSEARGLEEKPTIAFATIPAAGGVIQTVA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IMAGE:5164497
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P85037
HTS Code 3002150000
Gene ID 221937
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FOXK1 Antibody 100ul

Anti-FOXK1 Antibody 100ul