MAS1L,dJ994E9.2
  • MAS1L,dJ994E9.2

Anti-MAS1L Antibody 100ul

Ref: AN-HPA017983-100ul
Anti-MAS1L

Información del producto

Polyclonal Antibody against Human MAS1L, Gene description: MAS1 proto-oncogene like, G protein-coupled receptor, Alternative Gene Names: dJ994E9.2, MAS-L, MRG, Validated applications: ICC, IHC, Uniprot ID: P35410, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAS1L
Gene Description MAS1 proto-oncogene like, G protein-coupled receptor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence ICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQQALPLNIIA
Immunogen ICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQQALPLNIIA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names dJ994E9.2, MAS-L, MRG
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P35410
HTS Code 3002150000
Gene ID 116511
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAS1L Antibody 100ul

Anti-MAS1L Antibody 100ul