LSM14A,C19orf13
  • LSM14A,C19orf13

Anti-LSM14A Antibody 100ul

Ref: AN-HPA017961-100ul
Anti-LSM14A

Información del producto

Polyclonal Antibody against Human LSM14A, Gene description: LSM14A, SCD6 homolog A (S. cerevisiae), Alternative Gene Names: C19orf13, DKFZP434D1335, FAM61A, RAP55, RAP55A, Validated applications: ICC, IHC, WB, Uniprot ID: Q8ND56, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LSM14A
Gene Description LSM14A, SCD6 homolog A (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence MGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVS
Immunogen MGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C19orf13, DKFZP434D1335, FAM61A, RAP55, RAP55A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8ND56
HTS Code 3002150000
Gene ID 26065
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LSM14A Antibody 100ul

Anti-LSM14A Antibody 100ul