BCL10,c-E10,CARMEN
  • BCL10,c-E10,CARMEN

Anti-BCL10 Antibody 25ul

Ref: AN-HPA017925-25ul
Anti-BCL10

Información del producto

Polyclonal Antibody against Human BCL10, Gene description: B-cell CLL/lymphoma 10, Alternative Gene Names: c-E10, CARMEN, CIPER, CLAP, mE10, Validated applications: IHC, WB, Uniprot ID: O95999, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BCL10
Gene Description B-cell CLL/lymphoma 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRT
Immunogen MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names c-E10, CARMEN, CIPER, CLAP, mE10
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95999
HTS Code 3002150000
Gene ID 8915
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BCL10 Antibody 25ul

Anti-BCL10 Antibody 25ul