RFFL,fring
  • RFFL,fring

Anti-RFFL Antibody 100ul

Ref: AN-HPA017910-100ul
Anti-RFFL

Información del producto

Polyclonal Antibody against Human RFFL, Gene description: ring finger and FYVE-like domain containing E3 ubiquitin protein ligase, Alternative Gene Names: fring, rififylin, RNF189, RNF34L, Validated applications: ICC, WB, Uniprot ID: Q8WZ73, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RFFL
Gene Description ring finger and FYVE-like domain containing E3 ubiquitin protein ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence AQATSVPPAQVQENQQANGHVSQDQEEPVYLESVARVPAEDETQSIDSEDSFVPGRRASLSDLTDLEDIEGLTVRQLKEILARNF
Immunogen AQATSVPPAQVQENQQANGHVSQDQEEPVYLESVARVPAEDETQSIDSEDSFVPGRRASLSDLTDLEDIEGLTVRQLKEILARNF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names fring, rififylin, RNF189, RNF34L
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WZ73
HTS Code 3002150000
Gene ID 117584
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RFFL Antibody 100ul

Anti-RFFL Antibody 100ul