ZBTB24,BIF1
  • ZBTB24,BIF1

Anti-ZBTB24 Antibody 25ul

Ref: AN-HPA017872-25ul
Anti-ZBTB24

Información del producto

Polyclonal Antibody against Human ZBTB24, Gene description: zinc finger and BTB domain containing 24, Alternative Gene Names: BIF1, KIAA0441, PATZ2, ZNF450, Validated applications: ICC, IHC, Uniprot ID: O43167, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZBTB24
Gene Description zinc finger and BTB domain containing 24
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QLQPYQLSTSGEQEIQLLVTDSVHNINFMPGPSQGISIVTAESSQNMTADQAANLTLLTQQPEQLQNLILSAQQEQTEHIQSLNMIESQMGPSQTEPVHVITLSKETLEHLHAHQEQTEELHLATSTSDPAQH
Immunogen QLQPYQLSTSGEQEIQLLVTDSVHNINFMPGPSQGISIVTAESSQNMTADQAANLTLLTQQPEQLQNLILSAQQEQTEHIQSLNMIESQMGPSQTEPVHVITLSKETLEHLHAHQEQTEELHLATSTSDPAQH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BIF1, KIAA0441, PATZ2, ZNF450
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43167
HTS Code 3002150000
Gene ID 9841
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZBTB24 Antibody 25ul

Anti-ZBTB24 Antibody 25ul