ENTPD2,CD39L1
  • ENTPD2,CD39L1

Anti-ENTPD2 Antibody 100ul

Ref: AN-HPA017676-100ul
Anti-ENTPD2

Información del producto

Polyclonal Antibody against Human ENTPD2, Gene description: ectonucleoside triphosphate diphosphohydrolase 2, Alternative Gene Names: CD39L1, NTPDase-2, Validated applications: IHC, WB, Uniprot ID: Q9Y5L3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ENTPD2
Gene Description ectonucleoside triphosphate diphosphohydrolase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence SHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGW
Immunogen SHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD39L1, NTPDase-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5L3
HTS Code 3002150000
Gene ID 954
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ENTPD2 Antibody 100ul

Anti-ENTPD2 Antibody 100ul