SNW1,Bx42,NCoA-62
  • SNW1,Bx42,NCoA-62

Anti-SNW1 Antibody 100ul

Ref: AN-HPA017370-100ul
Anti-SNW1

Información del producto

Polyclonal Antibody against Human SNW1, Gene description: SNW domain containing 1, Alternative Gene Names: Bx42, NCoA-62, Prp45, PRPF45, SKIIP, SKIP, Validated applications: ICC, WB, Uniprot ID: Q13573, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SNW1
Gene Description SNW domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, ICC
Sequence MSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKK
Immunogen MSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Bx42, NCoA-62, Prp45, PRPF45, SKIIP, SKIP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13573
HTS Code 3002150000
Gene ID 22938
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SNW1 Antibody 100ul

Anti-SNW1 Antibody 100ul