EPSTI1,BRESI1
  • EPSTI1,BRESI1

Anti-EPSTI1 Antibody 25ul

Ref: AN-HPA017362-25ul
Anti-EPSTI1

Información del producto

Polyclonal Antibody against Human EPSTI1, Gene description: epithelial stromal interaction 1 (breast), Alternative Gene Names: BRESI1, MGC29634, Validated applications: IHC, Uniprot ID: Q96J88, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EPSTI1
Gene Description epithelial stromal interaction 1 (breast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTEHRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSW
Immunogen ARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTEHRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BRESI1, MGC29634
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96J88
HTS Code 3002150000
Gene ID 94240
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EPSTI1 Antibody 25ul

Anti-EPSTI1 Antibody 25ul