FAR1,FLJ22728
  • FAR1,FLJ22728

Anti-FAR1 Antibody 25ul

Ref: AN-HPA017322-25ul
Anti-FAR1

Información del producto

Polyclonal Antibody against Human FAR1, Gene description: fatty acyl CoA reductase 1, Alternative Gene Names: FLJ22728, MLSTD2, SDR10E1, Validated applications: ICC, IHC, WB, Uniprot ID: Q8WVX9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAR1
Gene Description fatty acyl CoA reductase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence YYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKIIAINSELTQPKLALSEEDKEVIIDSTNIIFHCAATVRFNENLRDAVQLNVIATRQLILLAQQMKNLEVFM
Immunogen YYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKIIAINSELTQPKLALSEEDKEVIIDSTNIIFHCAATVRFNENLRDAVQLNVIATRQLILLAQQMKNLEVFM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22728, MLSTD2, SDR10E1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WVX9
HTS Code 3002150000
Gene ID 84188
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAR1 Antibody 25ul

Anti-FAR1 Antibody 25ul