IFNLR1,CRF2/12
  • IFNLR1,CRF2/12

Anti-IFNLR1 Antibody 100ul

Ref: AN-HPA017319-100ul
Anti-IFNLR1

Información del producto

Polyclonal Antibody against Human IFNLR1, Gene description: interferon, lambda receptor 1, Alternative Gene Names: CRF2/12, IFNLR, IL-28R1, IL28RA, Validated applications: IHC, Uniprot ID: Q8IU57, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IFNLR1
Gene Description interferon, lambda receptor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEAN
Immunogen FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEAN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CRF2/12, IFNLR, IL-28R1, IL28RA
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IU57
HTS Code 3002150000
Gene ID 163702
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IFNLR1 Antibody 100ul

Anti-IFNLR1 Antibody 100ul