ARPP21,ARPP-21
  • ARPP21,ARPP-21

Anti-ARPP21 Antibody 25ul

Ref: AN-HPA017303-25ul
Anti-ARPP21

Información del producto

Polyclonal Antibody against Human ARPP21, Gene description: cAMP-regulated phosphoprotein, 21kDa, Alternative Gene Names: ARPP-21, R3HDM3, TARPP, Validated applications: IHC, Uniprot ID: Q9UBL0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ARPP21
Gene Description cAMP-regulated phosphoprotein, 21kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLAVCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEKDKNKDKTSEKPKIRMLSKDCSQEYT
Immunogen EQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLAVCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEKDKNKDKTSEKPKIRMLSKDCSQEYT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARPP-21, R3HDM3, TARPP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UBL0
HTS Code 3002150000
Gene ID 10777
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARPP21 Antibody 25ul

Anti-ARPP21 Antibody 25ul