LRCH3,MGC4126
  • LRCH3,MGC4126

Anti-LRCH3 Antibody 100ul

Ref: AN-HPA017299-100ul
Anti-LRCH3

Información del producto

Polyclonal Antibody against Human LRCH3, Gene description: leucine-rich repeats and calponin homology (CH) domain containing 3, Alternative Gene Names: MGC4126, Validated applications: ICC, Uniprot ID: Q96II8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LRCH3
Gene Description leucine-rich repeats and calponin homology (CH) domain containing 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence NLCSPSDILQLNLSVKRTVETLLSLGAHSEESSFVCLSL
Immunogen NLCSPSDILQLNLSVKRTVETLLSLGAHSEESSFVCLSL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC4126
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96II8
HTS Code 3002150000
Gene ID 84859
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LRCH3 Antibody 100ul

Anti-LRCH3 Antibody 100ul