TARDBP,ALS10,TDP-43
  • TARDBP,ALS10,TDP-43

Anti-TARDBP Antibody 25ul

Ref: AN-HPA017284-25ul
Anti-TARDBP

Información del producto

Polyclonal Antibody against Human TARDBP, Gene description: TAR DNA binding protein, Alternative Gene Names: ALS10, TDP-43, Validated applications: ICC, IHC, WB, Uniprot ID: Q13148, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TARDBP
Gene Description TAR DNA binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence VTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNN
Immunogen VTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ALS10, TDP-43
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13148
HTS Code 3002150000
Gene ID 23435
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TARDBP Antibody 25ul

Anti-TARDBP Antibody 25ul