ERV3-1,envR,ERV-R
  • ERV3-1,envR,ERV-R

Anti-ERV3-1 Antibody 25ul

Ref: AN-HPA017209-25ul
Anti-ERV3-1

Información del producto

Polyclonal Antibody against Human ERV3-1, Gene description: endogenous retrovirus group 3, member 1, Alternative Gene Names: envR, ERV-R, ERV3, H-PLK, HERV-R, Validated applications: IHC, WB, Uniprot ID: Q14264, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ERV3-1
Gene Description endogenous retrovirus group 3, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence QLAENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWGKAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEA
Immunogen QLAENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWGKAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names envR, ERV-R, ERV3, H-PLK, HERV-R
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14264
HTS Code 3002150000
Gene ID 2086
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ERV3-1 Antibody 25ul

Anti-ERV3-1 Antibody 25ul