LGI2,FLJ10675
  • LGI2,FLJ10675

Anti-LGI2 Antibody 100ul

Ref: AN-HPA017140-100ul
Anti-LGI2

Información del producto

Polyclonal Antibody against Human LGI2, Gene description: leucine-rich repeat LGI family, member 2, Alternative Gene Names: FLJ10675, KIAA1916, Validated applications: ICC, IHC, WB, Uniprot ID: Q8N0V4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LGI2
Gene Description leucine-rich repeat LGI family, member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence DLTHLSLANNHIKALPRDVFSDLDSLIELDLRGNKFECDCKAKWLYLWLKMTNSTVSDVLCIGPPEYQEKKLNDVTSFDYECTTTDFVVHQTLPYQSVSVDTFNSKNDVYVAIAQPSMENCMVLEW
Immunogen DLTHLSLANNHIKALPRDVFSDLDSLIELDLRGNKFECDCKAKWLYLWLKMTNSTVSDVLCIGPPEYQEKKLNDVTSFDYECTTTDFVVHQTLPYQSVSVDTFNSKNDVYVAIAQPSMENCMVLEW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10675, KIAA1916
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N0V4
HTS Code 3002150000
Gene ID 55203
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LGI2 Antibody 100ul

Anti-LGI2 Antibody 100ul