CDHR2,FLJ20124
  • CDHR2,FLJ20124

Anti-CDHR2 Antibody 25ul

Ref: AN-HPA017053-25ul
Anti-CDHR2

Información del producto

Polyclonal Antibody against Human CDHR2, Gene description: cadherin-related family member 2, Alternative Gene Names: FLJ20124, FLJ20383, PC-LKC, PCDH24, PCLKC, Validated applications: IHC, Uniprot ID: Q9BYE9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CDHR2
Gene Description cadherin-related family member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DVSLDYETQPVFNLTVSAENPDPQGGETIVDVCVNVKDVNDNPPTLDVASLRGIRVAENGSQHGQVAVVVASDVDTSAQLEIQLVNILCTKAGVDVGSLCWGWFSVAANGSVYINQSKAIDYEACDLVTLVVRACDLATDP
Immunogen DVSLDYETQPVFNLTVSAENPDPQGGETIVDVCVNVKDVNDNPPTLDVASLRGIRVAENGSQHGQVAVVVASDVDTSAQLEIQLVNILCTKAGVDVGSLCWGWFSVAANGSVYINQSKAIDYEACDLVTLVVRACDLATDP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20124, FLJ20383, PC-LKC, PCDH24, PCLKC
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BYE9
HTS Code 3002150000
Gene ID 54825
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CDHR2 Antibody 25ul

Anti-CDHR2 Antibody 25ul