MRGBP,C20orf20,Eaf7
  • MRGBP,C20orf20,Eaf7

Anti-MRGBP Antibody 25ul

Ref: AN-HPA017012-25ul
Anti-MRGBP

Información del producto

Polyclonal Antibody against Human MRGBP, Gene description: MRG/MORF4L binding protein, Alternative Gene Names: C20orf20, Eaf7, FLJ10914, MRG15BP, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NV56, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MRGBP
Gene Description MRG/MORF4L binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence LFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKE
Immunogen LFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf20, Eaf7, FLJ10914, MRG15BP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NV56
HTS Code 3002150000
Gene ID 55257
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRGBP Antibody 25ul

Anti-MRGBP Antibody 25ul