PDLIM1,CLIM1,CLP-36
  • PDLIM1,CLIM1,CLP-36

Anti-PDLIM1 Antibody 100ul

Ref: AN-HPA017010-100ul
Anti-PDLIM1

Información del producto

Polyclonal Antibody against Human PDLIM1, Gene description: PDZ and LIM domain 1, Alternative Gene Names: CLIM1, CLP-36, CLP36, hCLIM1, Validated applications: IHC, WB, Uniprot ID: O00151, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PDLIM1
Gene Description PDZ and LIM domain 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence EKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTV
Immunogen EKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CLIM1, CLP-36, CLP36, hCLIM1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00151
HTS Code 3002150000
Gene ID 9124
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PDLIM1 Antibody 100ul

Anti-PDLIM1 Antibody 100ul