UTS2,PRO1068,U-II
  • UTS2,PRO1068,U-II

Anti-UTS2 Antibody 100ul

Ref: AN-HPA017000-100ul
Anti-UTS2

Información del producto

Polyclonal Antibody against Human UTS2, Gene description: urotensin 2, Alternative Gene Names: PRO1068, U-II, UCN2, UII, Validated applications: IHC, Uniprot ID: O95399, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UTS2
Gene Description urotensin 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
Immunogen TNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PRO1068, U-II, UCN2, UII
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95399
HTS Code 3002150000
Gene ID 10911
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UTS2 Antibody 100ul

Anti-UTS2 Antibody 100ul