ZBTB43,FLJ22470
  • ZBTB43,FLJ22470

Anti-ZBTB43 Antibody 100ul

Ref: AN-HPA016825-100ul
Anti-ZBTB43

Información del producto

Polyclonal Antibody against Human ZBTB43, Gene description: zinc finger and BTB domain containing 43, Alternative Gene Names: FLJ22470, KIAA0414, ZBTB22B, ZNF-X, ZNF297B, Validated applications: ICC, IHC, Uniprot ID: O43298, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZBTB43
Gene Description zinc finger and BTB domain containing 43
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence GVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIGHRQEAALAAGYSENIEMVTGIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGL
Immunogen GVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIGHRQEAALAAGYSENIEMVTGIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22470, KIAA0414, ZBTB22B, ZNF-X, ZNF297B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43298
HTS Code 3002150000
Gene ID 23099
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZBTB43 Antibody 100ul

Anti-ZBTB43 Antibody 100ul