DUSP10,MKP-5,MKP5
  • DUSP10,MKP-5,MKP5

Anti-DUSP10 Antibody 100ul

Ref: AN-HPA016758-100ul
Anti-DUSP10

Información del producto

Polyclonal Antibody against Human DUSP10, Gene description: dual specificity phosphatase 10, Alternative Gene Names: MKP-5, MKP5, Validated applications: ICC, IHC, Uniprot ID: Q9Y6W6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DUSP10
Gene Description dual specificity phosphatase 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence FMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQ
Immunogen FMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MKP-5, MKP5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y6W6
HTS Code 3002150000
Gene ID 11221
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DUSP10 Antibody 100ul

Anti-DUSP10 Antibody 100ul