PGAP3,CAB2,MGC9753
  • PGAP3,CAB2,MGC9753

Anti-PGAP3 Antibody 25ul

Ref: AN-HPA016591-25ul
Anti-PGAP3

Información del producto

Polyclonal Antibody against Human PGAP3, Gene description: post-GPI attachment to proteins 3, Alternative Gene Names: CAB2, MGC9753, PER1, PERLD1, PP1498, Validated applications: ICC, IHC, Uniprot ID: Q96FM1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PGAP3
Gene Description post-GPI attachment to proteins 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWP
Immunogen SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAB2, MGC9753, PER1, PERLD1, PP1498
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96FM1
HTS Code 3002150000
Gene ID 93210
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PGAP3 Antibody 25ul

Anti-PGAP3 Antibody 25ul