FAM134C
  • FAM134C

Anti-FAM134C Antibody 100ul

Ref: AN-HPA016492-100ul
Anti-FAM134C

Información del producto

Polyclonal Antibody against Human FAM134C, Gene description: family with sequence similarity 134, member C, Alternative Gene Names: DKFZp686B1036, FLJ33806, Validated applications: ICC, IHC, WB, Uniprot ID: Q86VR2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAM134C
Gene Description family with sequence similarity 134, member C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence DFPSINMDPAGLDDEDDTSIGMPSLMYRSPPGAEEPQAPPASRDEAALPELLLGALPVGSNLTSNLASLVSQGMIQLALSGASQPGPSGAPAQRATRGFLRSPSSDLDTDAEGDDFELLDQSE
Immunogen DFPSINMDPAGLDDEDDTSIGMPSLMYRSPPGAEEPQAPPASRDEAALPELLLGALPVGSNLTSNLASLVSQGMIQLALSGASQPGPSGAPAQRATRGFLRSPSSDLDTDAEGDDFELLDQSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp686B1036, FLJ33806
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86VR2
HTS Code 3002150000
Gene ID 162427
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAM134C Antibody 100ul

Anti-FAM134C Antibody 100ul