HHAT,FLJ10724,GUP2
  • HHAT,FLJ10724,GUP2

Anti-HHAT Antibody 25ul

Ref: AN-HPA016462-25ul
Anti-HHAT

Información del producto

Polyclonal Antibody against Human HHAT, Gene description: hedgehog acyltransferase, Alternative Gene Names: FLJ10724, GUP2, MART-2, MART2, rasp, sit, ski, Skn, Validated applications: ICC, IHC, Uniprot ID: Q5VTY9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HHAT
Gene Description hedgehog acyltransferase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VSREHEEELDQEFELETDTLFGGLKKDATDFEWSFWMEW
Immunogen VSREHEEELDQEFELETDTLFGGLKKDATDFEWSFWMEW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10724, GUP2, MART-2, MART2, rasp, sit, ski, Skn
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5VTY9
HTS Code 3002150000
Gene ID 55733
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HHAT Antibody 25ul

Anti-HHAT Antibody 25ul