KDELR2,ELP-1,ERD2.2
  • KDELR2,ELP-1,ERD2.2

Anti-KDELR2 Antibody 25ul

Ref: AN-HPA016459-25ul
Anti-KDELR2

Información del producto

Polyclonal Antibody against Human KDELR2, Gene description: KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2, Alternative Gene Names: ELP-1, ERD2.2, Validated applications: IHC, Uniprot ID: P33947, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KDELR2
Gene Description KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YSRERSSVCQHKCQRPSPASVLQGARTEFLPQQRHKMLDTENQKLNSFVADSHQWLCK
Immunogen YSRERSSVCQHKCQRPSPASVLQGARTEFLPQQRHKMLDTENQKLNSFVADSHQWLCK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ELP-1, ERD2.2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P33947
HTS Code 3002150000
Gene ID 11014
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KDELR2 Antibody 25ul

Anti-KDELR2 Antibody 25ul