KCNK1,DPK,K2p1.1
  • KCNK1,DPK,K2p1.1

Anti-KCNK1 Antibody 25ul

Ref: AN-HPA016049-25ul
Anti-KCNK1

Información del producto

Polyclonal Antibody against Human KCNK1, Gene description: potassium channel, subfamily K, member 1, Alternative Gene Names: DPK, K2p1.1, TWIK-1, Validated applications: ICC, IHC, Uniprot ID: O00180, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KCNK1
Gene Description potassium channel, subfamily K, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPAN
Immunogen YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPAN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DPK, K2p1.1, TWIK-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00180
HTS Code 3002150000
Gene ID 3775
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KCNK1 Antibody 25ul

Anti-KCNK1 Antibody 25ul