TLK1,KIAA0137
  • TLK1,KIAA0137

Anti-TLK1 Antibody 100ul

Ref: AN-HPA016043-100ul
Anti-TLK1

Información del producto

Polyclonal Antibody against Human TLK1, Gene description: tousled-like kinase 1, Alternative Gene Names: KIAA0137, PKU-BETA, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UKI8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TLK1
Gene Description tousled-like kinase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence ETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKL
Immunogen ETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0137, PKU-BETA
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UKI8
HTS Code 3002150000
Gene ID 9874
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TLK1 Antibody 100ul

Anti-TLK1 Antibody 100ul