MGARP,C4orf49
  • MGARP,C4orf49

Anti-MGARP Antibody 25ul

Ref: AN-HPA015994-25ul
Anti-MGARP

Información del producto

Polyclonal Antibody against Human MGARP, Gene description: mitochondria-localized glutamic acid-rich protein, Alternative Gene Names: C4orf49, CESP-1, HUMMR, OSAP, Validated applications: ICC, IHC, Uniprot ID: Q8TDB4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MGARP
Gene Description mitochondria-localized glutamic acid-rich protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence YKTVTSDQAKHTEHKTNLKEKTKAEIHPFQGEKENVAETEKASSEAPEELIVEAEVVDAEESPSATVVVIKEASACPGHVEAAPETTAVSAETGPEVTDAAA
Immunogen YKTVTSDQAKHTEHKTNLKEKTKAEIHPFQGEKENVAETEKASSEAPEELIVEAEVVDAEESPSATVVVIKEASACPGHVEAAPETTAVSAETGPEVTDAAA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C4orf49, CESP-1, HUMMR, OSAP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TDB4
HTS Code 3002150000
Gene ID 84709
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MGARP Antibody 25ul

Anti-MGARP Antibody 25ul