C1orf27,FLJ20505
  • C1orf27,FLJ20505

Anti-C1orf27 Antibody 25ul

Ref: AN-HPA015988-25ul
Anti-C1orf27

Información del producto

Polyclonal Antibody against Human C1orf27, Gene description: chromosome 1 open reading frame 27, Alternative Gene Names: FLJ20505, odr-4, TTG1, Validated applications: ICC, IHC, WB, Uniprot ID: Q5SWX8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C1orf27
Gene Description chromosome 1 open reading frame 27
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence FHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPIK
Immunogen FHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPIK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20505, odr-4, TTG1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5SWX8
HTS Code 3002150000
Gene ID 54953
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C1orf27 Antibody 25ul

Anti-C1orf27 Antibody 25ul