RNF112,BFP,ZNF179
  • RNF112,BFP,ZNF179

Anti-RNF112 Antibody 25ul

Ref: AN-HPA015970-25ul
Anti-RNF112

Información del producto

Polyclonal Antibody against Human RNF112, Gene description: ring finger protein 112, Alternative Gene Names: BFP, ZNF179, Validated applications: ICC, IHC, WB, Uniprot ID: Q9ULX5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RNF112
Gene Description ring finger protein 112
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LAQEIKNLSGWMGRTGPGFTSPDEMAAQLHDLRKVEAAKREFEEYVRQQDVATKRIFSALRVLPDTMRNLLSTQKDAILARHGVALLCKGRDQTLEALEAELQATAKAFMDSYT
Immunogen LAQEIKNLSGWMGRTGPGFTSPDEMAAQLHDLRKVEAAKREFEEYVRQQDVATKRIFSALRVLPDTMRNLLSTQKDAILARHGVALLCKGRDQTLEALEAELQATAKAFMDSYT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BFP, ZNF179
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9ULX5
HTS Code 3002150000
Gene ID 7732
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RNF112 Antibody 25ul

Anti-RNF112 Antibody 25ul