ERGIC3,C20orf47
  • ERGIC3,C20orf47

Anti-ERGIC3 Antibody 100ul

Ref: AN-HPA015968-100ul
Anti-ERGIC3

Información del producto

Polyclonal Antibody against Human ERGIC3, Gene description: ERGIC and golgi 3, Alternative Gene Names: C20orf47, CGI-54, Erv46, NY-BR-84, PRO0989, SDBCAG84, Validated applications: IHC, WB, Uniprot ID: Q9Y282, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ERGIC3
Gene Description ERGIC and golgi 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence NINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKH
Immunogen NINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf47, CGI-54, Erv46, NY-BR-84, PRO0989, SDBCAG84
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y282
HTS Code 3002150000
Gene ID 51614
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ERGIC3 Antibody 100ul

Anti-ERGIC3 Antibody 100ul