FAM3B,2-21,C21orf11
  • FAM3B,2-21,C21orf11

Anti-FAM3B Antibody 100ul

Ref: AN-HPA015885-100ul
Anti-FAM3B

Información del producto

Polyclonal Antibody against Human FAM3B, Gene description: family with sequence similarity 3, member B, Alternative Gene Names: 2-21, C21orf11, C21orf76, D21M16SJHU19e, ORF9, PANDER, PRED44, Validated applications: IHC, WB, Uniprot ID: P58499, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAM3B
Gene Description family with sequence similarity 3, member B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence TPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRN
Immunogen TPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 2-21, C21orf11, C21orf76, D21M16SJHU19e, ORF9, PANDER, PRED44
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P58499
HTS Code 3002150000
Gene ID 54097
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAM3B Antibody 100ul

Anti-FAM3B Antibody 100ul