PKD2,Pc-2,PC2,PKD4
  • PKD2,Pc-2,PC2,PKD4

Anti-PKD2 Antibody 25ul

Ref: AN-HPA015794-25ul
Anti-PKD2

Información del producto

Polyclonal Antibody against Human PKD2, Gene description: polycystic kidney disease 2 (autosomal dominant), Alternative Gene Names: Pc-2, PC2, PKD4, TRPP2, Validated applications: ICC, IHC, Uniprot ID: Q13563, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PKD2
Gene Description polycystic kidney disease 2 (autosomal dominant)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence REDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISH
Immunogen REDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Pc-2, PC2, PKD4, TRPP2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13563
HTS Code 3002150000
Gene ID 5311
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PKD2 Antibody 25ul

Anti-PKD2 Antibody 25ul