SALL4,dJ1112F19.1
  • SALL4,dJ1112F19.1

Anti-SALL4 Antibody 100ul

Ref: AN-HPA015791-100ul
Anti-SALL4

Información del producto

Polyclonal Antibody against Human SALL4, Gene description: spalt-like transcription factor 4, Alternative Gene Names: dJ1112F19.1, ZNF797, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UJQ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SALL4
Gene Description spalt-like transcription factor 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence HALHSSGAGADTLKTLGSHMSQQVSAAVALLSQKAGSQGLSLDALKQAKLPHANIPSATSSLSPGLAPFTLKPDGTRVLPNVMSRLPSALLPQAPGSVLFQSPFSTVALDTSKKGKGKPPNISAVDVKPKDE
Immunogen HALHSSGAGADTLKTLGSHMSQQVSAAVALLSQKAGSQGLSLDALKQAKLPHANIPSATSSLSPGLAPFTLKPDGTRVLPNVMSRLPSALLPQAPGSVLFQSPFSTVALDTSKKGKGKPPNISAVDVKPKDE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names dJ1112F19.1, ZNF797
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UJQ4
HTS Code 3002150000
Gene ID 57167
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SALL4 Antibody 100ul

Anti-SALL4 Antibody 100ul