CDK15,ALS2CR7
  • CDK15,ALS2CR7

Anti-CDK15 Antibody 100ul

Ref: AN-HPA015786-100ul
Anti-CDK15

Información del producto

Polyclonal Antibody against Human CDK15, Gene description: cyclin-dependent kinase 15, Alternative Gene Names: ALS2CR7, PFTAIRE2, PFTK2, Validated applications: ICC, IHC, Uniprot ID: Q96Q40, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CDK15
Gene Description cyclin-dependent kinase 15
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence PRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKPEMCDLLASYQKGHHPA
Immunogen PRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKPEMCDLLASYQKGHHPA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ALS2CR7, PFTAIRE2, PFTK2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96Q40
HTS Code 3002150000
Gene ID 65061
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CDK15 Antibody 100ul

Anti-CDK15 Antibody 100ul