CHMP3,CGI-149,NEDF
  • CHMP3,CGI-149,NEDF

Anti-CHMP3 Antibody 100ul

Ref: AN-HPA015673-100ul
Anti-CHMP3

Información del producto

Polyclonal Antibody against Human CHMP3, Gene description: charged multivesicular body protein 3, Alternative Gene Names: CGI-149, NEDF, VPS24, Validated applications: IHC, WB, Uniprot ID: Q9Y3E7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CHMP3
Gene Description charged multivesicular body protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence AMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLR
Immunogen AMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-149, NEDF, VPS24
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3E7
HTS Code 3002150000
Gene ID 51652
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CHMP3 Antibody 100ul

Anti-CHMP3 Antibody 100ul