RASGRP2,CALDAG-GEFI
  • RASGRP2,CALDAG-GEFI

Anti-RASGRP2 Antibody 100ul

Ref: AN-HPA015667-100ul
Anti-RASGRP2

Información del producto

Polyclonal Antibody against Human RASGRP2, Gene description: RAS guanyl releasing protein 2 (calcium and DAG-regulated), Alternative Gene Names: CALDAG-GEFI, Validated applications: IHC, WB, Uniprot ID: Q7LDG7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RASGRP2
Gene Description RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence DDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPV
Immunogen DDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CALDAG-GEFI
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7LDG7
HTS Code 3002150000
Gene ID 10235
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RASGRP2 Antibody 100ul

Anti-RASGRP2 Antibody 100ul