CD163L1,CD163B,M160
  • CD163L1,CD163B,M160

Anti-CD163L1 Antibody 100ul

Ref: AN-HPA015663-100ul
Anti-CD163L1

Información del producto

Polyclonal Antibody against Human CD163L1, Gene description: CD163 molecule-like 1, Alternative Gene Names: CD163B, M160, Validated applications: IHC, WB, Uniprot ID: Q9NR16, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CD163L1
Gene Description CD163 molecule-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDTSLLGVLPASEAT
Immunogen LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDTSLLGVLPASEAT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD163B, M160
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NR16
HTS Code 3002150000
Gene ID 283316
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CD163L1 Antibody 100ul

Anti-CD163L1 Antibody 100ul