SEMA4D,C9orf164
  • SEMA4D,C9orf164

Anti-SEMA4D Antibody 25ul

Ref: AN-HPA015662-25ul
Anti-SEMA4D

Información del producto

Polyclonal Antibody against Human SEMA4D, Gene description: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D, Alternative Gene Names: C9orf164, CD100, coll-4, FLJ39737, SEMAJ, Validated applications: IHC, WB, Uniprot ID: Q92854, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SEMA4D
Gene Description sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD
Immunogen LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf164, CD100, coll-4, FLJ39737, SEMAJ
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92854
HTS Code 3002150000
Gene ID 10507
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SEMA4D Antibody 25ul

Anti-SEMA4D Antibody 25ul