RTN3,ASYIP,HAP
  • RTN3,ASYIP,HAP

Anti-RTN3 Antibody 100ul

Ref: AN-HPA015650-100ul
Anti-RTN3

Información del producto

Polyclonal Antibody against Human RTN3, Gene description: reticulon 3, Alternative Gene Names: ASYIP, HAP, NSPL2, NSPLII, RTN3-A1, Validated applications: ICC, IHC, Uniprot ID: O95197, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RTN3
Gene Description reticulon 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence IMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKDHLDLLDMKKMEKPQGTSNNVSDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQIDKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEY
Immunogen IMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKDHLDLLDMKKMEKPQGTSNNVSDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQIDKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ASYIP, HAP, NSPL2, NSPLII, RTN3-A1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95197
HTS Code 3002150000
Gene ID 10313
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RTN3 Antibody 100ul

Anti-RTN3 Antibody 100ul