TSPAN2,FLJ12082
  • TSPAN2,FLJ12082

Anti-TSPAN2 Antibody 100ul

Ref: AN-HPA015640-100ul
Anti-TSPAN2

Información del producto

Polyclonal Antibody against Human TSPAN2, Gene description: tetraspanin 2, Alternative Gene Names: FLJ12082, TSN2, TSPAN-2, Validated applications: ICC, IHC, Uniprot ID: O60636, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TSPAN2
Gene Description tetraspanin 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQ
Immunogen VAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ12082, TSN2, TSPAN-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60636
HTS Code 3002150000
Gene ID 10100
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TSPAN2 Antibody 100ul

Anti-TSPAN2 Antibody 100ul