APOBEC4,C1orf169
  • APOBEC4,C1orf169

Anti-APOBEC4 Antibody 25ul

Ref: AN-HPA015637-25ul
Anti-APOBEC4

Información del producto

Polyclonal Antibody against Human APOBEC4, Gene description: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 4 (putative), Alternative Gene Names: C1orf169, FLJ25691, MGC26594, RP1-127C7.4, Validated applications: IHC, Uniprot ID: Q8WW27, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name APOBEC4
Gene Description apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 4 (putative)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NFLITYPGITLSIYFSQLYHTEMDFPASAWNREALRSLASLWPRVVLSPISGGIWHSVLHSFISGVSGSHVFQPILTGRALADRHNAYEINAITGVKPYFTDVLLQTKRNPNTKAQEALESYPLNNAFPGQFFQMPSGQLQPNLPPDL
Immunogen NFLITYPGITLSIYFSQLYHTEMDFPASAWNREALRSLASLWPRVVLSPISGGIWHSVLHSFISGVSGSHVFQPILTGRALADRHNAYEINAITGVKPYFTDVLLQTKRNPNTKAQEALESYPLNNAFPGQFFQMPSGQLQPNLPPDL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf169, FLJ25691, MGC26594, RP1-127C7.4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WW27
HTS Code 3002150000
Gene ID 403314
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-APOBEC4 Antibody 25ul

Anti-APOBEC4 Antibody 25ul