SH3GLB1,Bif-1
  • SH3GLB1,Bif-1

Anti-SH3GLB1 Antibody 100ul

Ref: AN-HPA015608-100ul
Anti-SH3GLB1

Información del producto

Polyclonal Antibody against Human SH3GLB1, Gene description: SH3-domain GRB2-like endophilin B1, Alternative Gene Names: Bif-1, CGI-61, KIAA0491, PPP1R70, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y371, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SH3GLB1
Gene Description SH3-domain GRB2-like endophilin B1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence DRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKER
Immunogen DRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKER
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Bif-1, CGI-61, KIAA0491, PPP1R70
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y371
HTS Code 3002150000
Gene ID 51100
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SH3GLB1 Antibody 100ul

Anti-SH3GLB1 Antibody 100ul