WNK2,KIAA1760
  • WNK2,KIAA1760

Anti-WNK2 Antibody 25ul

Ref: AN-HPA015555-25ul
Anti-WNK2

Información del producto

Polyclonal Antibody against Human WNK2, Gene description: WNK lysine deficient protein kinase 2, Alternative Gene Names: KIAA1760, NY-CO-43, PRKWNK2, SDCCAG43, Validated applications: ICC, IHC, Uniprot ID: Q9Y3S1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WNK2
Gene Description WNK lysine deficient protein kinase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence KHLKEISELQSQQKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSKSKLKAGKLLNPLVRQLKVVASST
Immunogen KHLKEISELQSQQKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSKSKLKAGKLLNPLVRQLKVVASST
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1760, NY-CO-43, PRKWNK2, SDCCAG43
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3S1
HTS Code 3002150000
Gene ID 65268
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WNK2 Antibody 25ul

Anti-WNK2 Antibody 25ul